| 产品详情 |
| Edit |   |
| Antigenic Specificity | DHRS9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DHRS9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DHRS9. This antibody reacts with human. The DHRS9 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DHRS9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGN |
| Other Names | dehydrogenase/reductase (SDR family) member 9,3alpha-HSD, EC 1.1, EC 1.1.1, EC 1.1.1.105, member 4,3-alpha-HSD, NADP-dependent retinol dehydrogenase/reductase, RDH15, RDH-E2, RDHL3ALPHA-HSD, RDHTBE |
| Gene, Accession # | DHRS9, Gene ID: 10170 |
| Catalog # | NBP1-89379 |
| Price | |
| Order / More Info | DHRS9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|