| Edit |   |
| Antigenic Specificity | PSG9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-PSG9 Antibody |
| Immunogen | The immunogen for anti-PSG9 antibody: synthetic peptide directed towards the N terminal of human PSG9. Synthetic peptide located within the following region: YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI |
| Other Names | n/a |
| Gene, Accession # | PSG9, Accession: NM_002784 |
| Catalog # | TA346332 |
| Price | |
| Order / More Info | PSG9 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |