| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LRRN4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LRRN4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRN4. This antibody reacts with human. The LRRN4 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human LRRN4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('SNSSVFPRAASTTRTQHRGEHAPELVLEPDISAASTPLASKLLGPFPTSWDRSISSPQPGQRTHATPQAPNPSLSEGEIPVLLLDDY',) |
|---|
| Other Names | C20orf75, chromosome 20 open reading frame 75, dJ1056H1.1, FLJ23994, leucine rich repeat neuronal 4, leucine-rich repeat neuronal protein 4, MGC25027, Neuronal leucine-rich repeat protein 4, NLRR4, NLRR-4 |
|---|
| Gene, Accession # | LRRN4, Gene ID: 164312 |
|---|
| Catalog # | NBP2-56591 |
|---|
| Price | |
|---|
| Order / More Info | LRRN4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|