| Edit |   |
|---|
| Antigenic Specificity | LRRN4CL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LRRN4CL Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRN4CL. This antibody reacts with human. The LRRN4CL Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human LRRN4CL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QDFEEEEADETETAWPPLPAVPCDYDHCRHLQVPCKELQRVGPAACLCPGLSSPAQPPDPPRMGEVRIAAEEGRAVVHWCA |
|---|
| Other Names | LRRN4 C-terminal like, LRRN4 C-terminal-like protein, MGC61707 |
|---|
| Gene, Accession # | LRRN4CL, Gene ID: 221091, Accession: Q8ND94, SwissProt: Q8ND94 |
|---|
| Catalog # | NBP2-30871 |
|---|
| Price | |
|---|
| Order / More Info | LRRN4CL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|