| Edit |   |
| Antigenic Specificity | LRRN4CL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LRRN4CL Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRN4CL. This antibody reacts with human. The LRRN4CL Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LOC221091 The peptide sequence was selected from the middle region of LOC221091. Peptide sequence PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAA. |
| Other Names | LRRN4 C-terminal like, LRRN4 C-terminal-like protein, MGC61707 |
| Gene, Accession # | LRRN4CL, Gene ID: 221091, Accession: Q8ND94, SwissProt: Q8ND94 |
| Catalog # | NBP1-60105-20ul |
| Price | |
| Order / More Info | LRRN4CL Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |