| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LRRN3/NLRR-3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LRRN3/NLRR-3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRN3/NLRR-3. This antibody reacts with human. The LRRN3/NLRR-3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LRRN3/NLRR-3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VDPPEFQGQNVRQVHFRDMMEICLPLIAPESFPSNLNVEAGSYVSFHCRATAEPQPEIYWITP |
|---|
| Other Names | FIGLER5, immunoglobulin and leucine rich repeat domains 5, leucine rich repeat neuronal 3, leucine-rich repeat neuronal protein 3, leucine-rich repeat protein, neuronal 3, Neuronal leucine-rich repeat protein 3, NLRR3, NLRR-3 |
|---|
| Gene, Accession # | LRRN3, Gene ID: 54674, Accession: Q9H3W5, SwissProt: Q9H3W5 |
|---|
| Catalog # | NBP2-30485 |
|---|
| Price | |
|---|
| Order / More Info | LRRN3/NLRR-3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|