| 产品详情 |
| Edit |   |
| Antigenic Specificity | GEM |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GEM Antibody from Novus Biologicals is a rabbit polyclonal antibody to GEM. This antibody reacts with human, mouse. The GEM Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. |
| Immunogen | Synthetic peptides corresponding to GEM(GTP binding protein overexpressed in skeletal muscle) The peptide sequence was selected from the C terminal of GEM (NP_005252). Peptide sequence FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL. |
| Other Names | GTP binding protein overexpressed in skeletal muscle, GTP-binding mitogen-induced T-cell protein, GTP-binding protein GEM, GTP-binding protein overexpressed in skeletal muscle, kinase-inducible Ras-like protein, KIRMGC26294, RAS-like protein KIR |
| Gene, Accession # | GEM, Gene ID: 2669, Accession: P55040, SwissProt: P55040 |
| Catalog # | NBP1-58906 |
| Price | |
| Order / More Info | GEM Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24809506, 25175477 |
| 产品资料 |
|
|