| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TBRG4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TBRG4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TBRG4. This antibody reacts with human. The TBRG4 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human TBRG4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FHQLLCLLNSQIASVWHGTLSKLLGSLYALGIPKASKELQSVEQEVRWRMRKLKYKHLAFLAESCATLSQEQHSQELLAELLTHLERRWTEIEDSHTLVTVMMKVG |
|---|
| Other Names | cell cycle progression 2 protein, Cell cycle progression protein 2, Cell cycle progression restoration protein 2, CPR2, FAST kinase domains 4, FASTKD4Cpr2, KIAA0948H_TD2522F11.8, protein TBRG4, transforming growth factor beta regulator 4FAST kinase domain-containing protein 4 |
|---|
| Gene, Accession # | TBRG4, Gene ID: 9238 |
|---|
| Catalog # | NBP2-58726 |
|---|
| Price | |
|---|
| Order / More Info | TBRG4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|