| Edit |   |
| Antigenic Specificity | DC-STAMP/TM7SF4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DC-STAMP/TM7SF4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DC-STAMP/TM7SF4. This antibody reacts with human. The DC-STAMP/TM7SF4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human TM7SF4The immunogen for this antibody is TM7SF4. Peptide sequence AGTGIVILGHVENIFHNFKGLLDGMTCNLRAKSFSIHFPLLKKYIEAIQW. |
| Other Names | dendritic cell-specific transmembrane protein, transmembrane 7 superfamily member 4 |
| Gene, Accession # | DCSTAMP, Gene ID: 81501, Accession: NP_110415, SwissProt: NP_110415 |
| Catalog # | NBP1-79329 |
| Price | |
| Order / More Info | DC-STAMP/TM7SF4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |