| Edit |   |
|---|
| Antigenic Specificity | DC-STAMP/TM7SF4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DC-STAMP/TM7SF4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DC-STAMP/TM7SF4. This antibody reacts with human. The DC-STAMP/TM7SF4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human TM7SF4The immunogen for this antibody is TM7SF4. Peptide sequence AGTGIVILGHVENIFHNFKGLLDGMTCNLRAKSFSIHFPLLKKYIEAIQW. |
|---|
| Other Names | dendritic cell-specific transmembrane protein, transmembrane 7 superfamily member 4 |
|---|
| Gene, Accession # | DCSTAMP, Gene ID: 81501, Accession: NP_110415, SwissProt: NP_110415 |
|---|
| Catalog # | NBP1-79329-20ul |
|---|
| Price | |
|---|
| Order / More Info | DC-STAMP/TM7SF4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|