| Edit |   |
|---|
| Antigenic Specificity | Tigd5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat, dog, bovine, mouse, human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-Tigd5 Antibody |
|---|
| Immunogen | The immunogen for Anti-Tigd5 Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tigd5. Synthetic peptide located within the following region: PGSTARPPPPPAPGPRPRVAVKMTFRKAYSIKDKLQAIERVKGGERQASV |
|---|
| Other Names | tigger transposable element derived 5 |
|---|
| Gene, Accession # | Tigd5, Accession: NM_178646 |
|---|
| Catalog # | TA333421 |
|---|
| Price | |
|---|
| Order / More Info | Tigd5 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|