| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Map17 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Map17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Map17. This antibody reacts with human. The Map17 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Map17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRST |
|---|
| Other Names | 17 kDa membrane-associated protein, DD96, MAP17epithelial protein up-regulated in carcinoma, membrane associated protein 17, membrane-associated protein 17, PDZK1 interacting protein 1, PDZK1-interacting protein 1, Protein DD96, RP1-18D14.5, SPAP |
|---|
| Gene, Accession # | PDZK1IP1, Gene ID: 10158 |
|---|
| Catalog # | NBP1-84290 |
|---|
| Price | |
|---|
| Order / More Info | Map17 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|