| Edit |   |
| Antigenic Specificity | SIAH3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, horse, dog, rabbit |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-SIAH3 Antibody |
| Immunogen | The immunogen for anti-SIAH3 antibody is: synthetic peptide directed towards the N-terminal region of Human SIAH3. Synthetic peptide located within the following region: YVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEA |
| Other Names | siah E3 ubiquitin protein ligase family member 3 |
| Gene, Accession # | SIAH3, Accession: NM_198849 |
| Catalog # | TA334840 |
| Price | |
| Order / More Info | SIAH3 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |