| Edit |   |
| Antigenic Specificity | Njmu-R1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Njmu-R1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Njmu-R1. This antibody reacts with human. The Njmu-R1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to Njmu-R1 The peptide sequence was selected from the middle region of Njmu-R1)(50ug). Peptide sequence KLKAIQDTNNLKRFIRQAEMNHYALFKCYMFLKNCGSGDILLKIVKVEHE. |
| Other Names | chromosome 17 open reading frame 75, NJMU-R1, protein Njmu-R1, spermatogenesis-related protein |
| Gene, Accession # | C17ORF75, Gene ID: 64149, Accession: Q9HAS0, SwissProt: Q9HAS0 |
| Catalog # | NBP1-57746 |
| Price | |
| Order / More Info | Njmu-R1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |