| Edit |   |
| Antigenic Specificity | NKAPD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NKAPD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NKAPD1. This antibody reacts with human. The NKAPD1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C11ORF57 The peptide sequence was selected from the middle region of C11ORF57. Peptide sequence RWGHSGYKELYPEEFETDSSDQQDITNGKKTSPQVKSSTHESRKHKKSKK. |
| Other Names | C11orf57, chromosome 11 open reading frame 57, FLJ10726, hypothetical protein LOC55216 |
| Gene, Accession # | C11ORF57, Gene ID: 55216, Accession: Q6ZUT1-2, SwissProt: Q6ZUT1-2 |
| Catalog # | NBP1-56475 |
| Price | |
| Order / More Info | NKAPD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |