| Edit |   |
| Antigenic Specificity | SEP15 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SEP15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SEP15. This antibody reacts with human. The SEP15 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human SEP15The immunogen for this antibody is SEP15 (NP_004252). Peptide Sequence: SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS |
| Other Names | 15 kDa selenoprotein |
| Gene, Accession # | SEPT15, Gene ID: 9403, Accession: O60613, SwissProt: O60613 |
| Catalog # | NBP1-91629 |
| Price | |
| Order / More Info | SEP15 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |