| Edit |   |
|---|
| Antigenic Specificity | SAPCD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SAPCD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SAPCD2. This antibody reacts with human. The SAPCD2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SAPCD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ELEQEKEVLLQGLEMMARGRDWYQQQLQRVQERQRRLGQSRASADFGAAGSPRPLGRLLPKVQEVARC |
|---|
| Other Names | C9orf140, chromosome 9 open reading frame 140, p42.3, SAPCD2, suppressor APC domain containing 2 |
|---|
| Gene, Accession # | SAPCD2, Gene ID: 89958, Accession: Q86UD0, SwissProt: Q86UD0 |
|---|
| Catalog # | NBP1-91740 |
|---|
| Price | |
|---|
| Order / More Info | SAPCD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|