| 产品详情 |
| Edit |   |
| Antigenic Specificity | SAPS3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SAPS3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SAPS3. This antibody reacts with human. The SAPS3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SAPS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DGAKQDLFEPSSANTEDKMEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTKETGWASFSEFTSSLSTKDSLRSNSPVEMETSTEP |
| Other Names | C11orf23SAPLa, chromosome 11 open reading frame 23, DKFZp781E17107, DKFZp781E2374, DKFZp781O2362, FLJ11058, FLJ43065, KIAA1558MGC125711, PP6R3MGC125712, protein phosphatase 6, regulatory subunit 3, SAPLSAP190, SAPS domain family member 3, SAPS3SAPS domain family, member 3, serine/threonine-protein phosphatase 6 regulatory subunit 3, Sporulation-induced transcript 4-associated protein SAPL |
| Gene, Accession # | PPP6R3, Gene ID: 55291, Accession: Q5H9R7, SwissProt: Q5H9R7 |
| Catalog # | NBP2-34048 |
| Price | |
| Order / More Info | SAPS3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|