| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | S100A7/Psoriasin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The S100A7/Psoriasin Antibody from Novus Biologicals is a rabbit polyclonal antibody to S100A7/Psoriasin. This antibody reacts with human. The S100A7/Psoriasin Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human S100A7/Psoriasin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS |
|---|
| Other Names | HID 5, HID5, HID-5, protein S100-A7, PSOR1, Psoriasin, psoriasin 1, S100 calcium binding protein A7, S100 calcium binding protein A7 (psoriasin 1), S100 calcium-binding protein A7, S100 calcium-binding protein A7 (psoriasin 1), S100A7c |
|---|
| Gene, Accession # | S100A7, Gene ID: 6278, Accession: P31151, SwissProt: P31151 |
|---|
| Catalog # | NBP1-87205 |
|---|
| Price | |
|---|
| Order / More Info | S100A7/Psoriasin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|