| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | S100A7/Psoriasin |
|---|
| Clone | 1C5-C6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The S100A7/Psoriasin Antibody (1C5-C6) from Novus Biologicals is a mouse monoclonal antibody to S100A7/Psoriasin. This antibody reacts with human. The S100A7/Psoriasin Antibody (1C5-C6) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | S100A7 (AAH34687.1, 1 a.a. - 101 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ |
|---|
| Other Names | HID 5, HID5, HID-5, protein S100-A7, PSOR1, Psoriasin, psoriasin 1, S100 calcium binding protein A7, S100 calcium binding protein A7 (psoriasin 1), S100 calcium-binding protein A7, S100 calcium-binding protein A7 (psoriasin 1), S100A7c |
|---|
| Gene, Accession # | S100A7, Gene ID: 6278, Accession: AAH34687, SwissProt: AAH34687 |
|---|
| Catalog # | H00006278-M01 |
|---|
| Price | |
|---|
| Order / More Info | S100A7/Psoriasin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|