| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SAR1B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SAR1B Antibody from Novus Biologicals is a rabbit polyclonal antibody to SAR1B. This antibody reacts with human. The SAR1B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SAR1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHE |
|---|
| Other Names | 2310075M17Rik, ANDD, CMRD, EC 3.6.5, GTP-binding protein B, GTP-binding protein SAR1b, GTP-binding protein Sara, SAR1 homolog B (S. cerevisiae), SAR1a gene homolog (S. cerevisiae) 2, SAR1a gene homolog 2, SAR1a gene homolog 2 (S. cerevisiae), SARA2GTBPB, SARB |
|---|
| Gene, Accession # | SAR1B, Gene ID: 51128, Accession: Q9Y6B6, SwissProt: Q9Y6B6 |
|---|
| Catalog # | NBP2-33521 |
|---|
| Price | |
|---|
| Order / More Info | SAR1B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|