| Edit |   |
|---|
| Antigenic Specificity | Sin3b |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-Sin3b Antibody |
|---|
| Immunogen | The immunogen for anti-Sin3b antibody: synthetic peptide directed towards the N terminal of mouse Sin3b. Synthetic peptide located within the following region: LSEFGQFLPEAKRSLFTGNGSCEMNSGQKNEEKSLEHNKKRSRPSLLRPV |
|---|
| Other Names | SIN3 transcription regulator family memberB |
|---|
| Gene, Accession # | Sin3b, Accession: NM_009188 |
|---|
| Catalog # | TA341814 |
|---|
| Price | |
|---|
| Order / More Info | Sin3b Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|