| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Thyroid receptor-interacting protein 12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Thyroid receptor-interacting protein 12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Thyroid receptor-interacting protein 12. This antibody reacts with human. The Thyroid receptor-interacting protein 12 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Thyroid receptor-interacting protein 12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQD |
|---|
| Other Names | EC 6.3.2.-, KIAA0045ULF, MGC138849, MGC138850, probable E3 ubiquitin-protein ligase TRIP12, thyroid hormone receptor interactor 12, thyroid receptor interacting protein 12, Thyroid receptor-interacting protein 12, TR-interacting protein 12, TRIP-12 |
|---|
| Gene, Accession # | TRIP12, Gene ID: 9320, Accession: Q14669, SwissProt: Q14669 |
|---|
| Catalog # | NBP2-34035 |
|---|
| Price | |
|---|
| Order / More Info | Thyroid receptor-interacting protein 12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|