| Edit |   |
|---|
| Antigenic Specificity | Thyrotropin Releasing Hormone |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Thyrotropin Releasing Hormone Antibody from Novus Biologicals is a rabbit polyclonal antibody to Thyrotropin Releasing Hormone. This antibody reacts with human. The Thyrotropin Releasing Hormone Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human TRH. Peptide sequence RALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPL. |
|---|
| Other Names | MGC125964, MGC125965, prothyroliberin, thyrotropin-releasing hormone |
|---|
| Gene, Accession # | TRH, Gene ID: 7200, Accession: NP_009048, SwissProt: NP_009048 |
|---|
| Catalog # | NBP1-79963-20ul |
|---|
| Price | |
|---|
| Order / More Info | Thyrotropin Releasing Hormone Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|