| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Tie-2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Tie-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tie-2. This antibody reacts with human. The Tie-2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Tie-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VISWTILDGYSISSITIRYKVQGKNEDQHVDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGSSNPAFSHELVTLPESQAPADL |
|---|
| Other Names | angiopoietin-1 receptor, CD202B, CD202b antigen, EC 2.7.10, EC 2.7.10.1, hTIE2, p140 TEK, soluble TIE2 variant 1, soluble TIE2 variant 2, TEK tyrosine kinase, endothelial, TIE-2, TIE2CD202b, Tunica interna endothelial cell kinase, Tyrosine-protein kinase receptor TEK, Tyrosine-protein kinase receptor TIE-2, venous malformations, multiple cutaneous and mucosal, VMCM, VMCM1 |
|---|
| Gene, Accession # | TEK, Gene ID: 7010 |
|---|
| Catalog # | NBP2-57894 |
|---|
| Price | |
|---|
| Order / More Info | Tie-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|