| Edit |   |
| Antigenic Specificity | Mafg |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-Mafg Antibody |
| Immunogen | The immunogen for Anti-Mafg antibody is: synthetic peptide directed towards the N-terminal region of Mouse Mafg. Synthetic peptide located within the following region: TPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIIQL |
| Other Names | hMAF, v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog G |
| Gene, Accession # | Mafg, Accession: NM_010756 |
| Catalog # | TA329748 |
| Price | |
| Order / More Info | Mafg Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |