| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Neuregulin-3/NRG3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Neuregulin-3/NRG3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Neuregulin-3/NRG3. This antibody reacts with human. The Neuregulin-3/NRG3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to NRG3(neuregulin 3) The peptide sequence was selected from the middle region of NRG3. Peptide sequence TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQM. |
|---|
| Other Names | HRG3, neuregulin 3, neuregulin 3 variant 1, neuregulin 3 variant 10, neuregulin 3 variant 11, neuregulin 3 variant 12, neuregulin 3 variant 13, neuregulin 3 variant 14, neuregulin 3 variant 3, neuregulin 3 variant 4, neuregulin 3 variant 5, neuregulin 3 variant 6, neuregulin 3 variant 7, neuregulin 3 variant 8, neuregulin 3 variant 9, neuregulin-3-like polypeptide, pro-neuregulin-3, membrane-bound isoform, pro-NRG3 |
|---|
| Gene, Accession # | NRG3, Gene ID: 10718, Accession: P56975-4, SwissProt: P56975-4 |
|---|
| Catalog # | NBP1-59338 |
|---|
| Price | |
|---|
| Order / More Info | Neuregulin-3/NRG3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|