| Edit |   |
| Antigenic Specificity | Tetraspanin-31 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Tetraspanin-31 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tetraspanin-31. This antibody reacts with human. The Tetraspanin-31 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
| Immunogen | Synthetic peptides corresponding to TSPAN31(tetraspanin 31) The peptide sequence was selected form the middle region of TSPAN31. Peptide sequence CTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMR. |
| Other Names | sarcoma amplified sequence, Sarcoma-amplified sequence, SAStransmembrane 4 protein, tetraspanin 31, tetraspanin-31, tspan-31 |
| Gene, Accession # | TSPAN31, Gene ID: 6302, Accession: Q12999, SwissProt: Q12999 |
| Catalog # | NBP1-62311 |
| Price | |
| Order / More Info | Tetraspanin-31 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |