| Edit |   |
|---|
| Antigenic Specificity | RBM43 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, horse, bovine, rat, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-RBM43 Antibody |
|---|
| Immunogen | The immunogen for Anti-RBM43 Antibody is: synthetic peptide directed towards the N-terminal region of Human RBM43. Synthetic peptide located within the following region: VAYVIFKEKKVAENVIRQKKHWLARKTRHAELTVSLRVSHFGDKIFSSVN |
|---|
| Other Names | C2orf38, RNA binding motif protein 43 |
|---|
| Gene, Accession # | RBM43, Accession: NM_198557 |
|---|
| Catalog # | TA331521 |
|---|
| Price | |
|---|
| Order / More Info | RBM43 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|