| 产品详情 |
| Edit |   |
| Antigenic Specificity | UBASH3B/STS1/Tula-2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The UBASH3B/STS1/Tula-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBASH3B/STS1/Tula-2. This antibody reacts with human. The UBASH3B/STS1/Tula-2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human UBASH3B/STS1/Tula-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CEDSKVDALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKEDSAEVLKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQASH |
| Other Names | Cbl-interacting protein p70, Cbl-interacting protein Sts-1, KIAA1959SH3 domain-containing 70 kDa protein, suppressor of T-cell receptor signaling1, nm23-phosphorylated unknown substrate, MGC15437, nm23-phosphorylated unknown substrate, P70, STS1EC 3.1.3.48, STS-1ubiquitin-associated and SH3 domain-containing protein B, Suppressor of T-cell receptor signaling 1, T-cell ubiquitin ligand 2, TULA-2, Tyrosine-protein phosphatase STS1/TULA2, ubiquitin associated and SH3 domain containing B |
| Gene, Accession # | UBASH3B, Gene ID: 84959, Accession: Q8TF42, SwissProt: Q8TF42 |
| Catalog # | NBP2-34053 |
| Price | |
| Order / More Info | UBASH3B/STS1/Tula-2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|