| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UbcH5a/UBE2D1 |
|---|
| Clone | 2C6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UbcH5a/UBE2D1 Antibody (2C6) from Novus Biologicals is a mouse monoclonal antibody to UbcH5a/UBE2D1. This antibody reacts with human. The UbcH5a/UBE2D1 Antibody (2C6) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | UBE2D1 (NP_003329, 1 a.a. - 94 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWS |
|---|
| Other Names | E2(17)KB1, Stimulator of Fe transportUBC4/5 homolog, UBC4/5, UBC5A, UbcH5, UbcH5A, UBCH5AEC 6.3.2.19, UBCH5SFT, Ubiquitin carrier protein D1, ubiquitin-conjugating enzyme E2 D1, Ubiquitin-conjugating enzyme E2(17)KB 1, Ubiquitin-conjugating enzyme E2-17 kDa 1, ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast), Ubiquitin-protein ligase D1 |
|---|
| Gene, Accession # | UBE2D1, Gene ID: 7321, Accession: NP_003329, SwissProt: NP_003329 |
|---|
| Catalog # | H00007321-M01 |
|---|
| Price | |
|---|
| Order / More Info | UbcH5a/UBE2D1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24574411 |
|---|
| 产品资料 |
|
|