| Edit |   |
| Antigenic Specificity | VPS8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The VPS8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VPS8. This antibody reacts with human. The VPS8 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human VPS8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EEIYPYIRTLLHFDTREFLNVLALTFEDFKNDKQAVEYQQRIVDILLKVMVENSDFTPSQVGCLFTFLARQLA |
| Other Names | KIAA0804FLJ32099, vacuolar protein sorting 8 homolog (S. cerevisiae), vacuolar protein sorting-associated protein 8 homolog |
| Gene, Accession # | VPS8, Gene ID: 23355 |
| Catalog # | NBP1-82007 |
| Price | |
| Order / More Info | VPS8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |