| Edit |   |
| Antigenic Specificity | VPS8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The VPS8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VPS8. This antibody reacts with human. The VPS8 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to VPS8(vacuolar protein sorting 8 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS8. Peptide sequence CGFAKGQITMWDLASGKLLRSITDAHPPGTAILHIKFTDDPTLAICNDSG. |
| Other Names | KIAA0804FLJ32099, vacuolar protein sorting 8 homolog (S. cerevisiae), vacuolar protein sorting-associated protein 8 homolog |
| Gene, Accession # | VPS8, Gene ID: 23355, Accession: B9EIQ1, SwissProt: B9EIQ1 |
| Catalog # | NBP1-55274 |
| Price | |
| Order / More Info | VPS8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |