| 产品详情 |
| Edit |   |
| Antigenic Specificity | VPS37A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The VPS37A Antibody from Novus Biologicals is a rabbit polyclonal antibody to VPS37A. This antibody reacts with human, mouse, rat. The VPS37A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat VPS37A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDKYELLTQMKSTF |
| Other Names | ESCRT-I complex subunit VPS37A, FLJ32642, HCRP1FLJ42616, hepatocellular carcinoma related protein 1, Hepatocellular carcinoma-related protein 1, hVps37A, polyglutamine binding protein 2, PQBP2, vacuolar protein sorting 37 homolog A (S. cerevisiae), vacuolar protein sorting 37A, vacuolar protein sorting 37A (yeast), vacuolar protein sorting-associated protein 37A |
| Gene, Accession # | VPS37A, Gene ID: 137492 |
| Catalog # | NBP1-83528 |
| Price | |
| Order / More Info | VPS37A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|