| Edit |   |
|---|
| Antigenic Specificity | Complement Factor H-related 4/CFHR4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Complement Factor H-related 4/CFHR4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Complement Factor H-related 4/CFHR4. This antibody reacts with human. The Complement Factor H-related 4/CFHR4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is CFHR4 - C-terminal region. Peptide sequence SNGEWSEPPRCIHPCIITEENMNKNNIQLKGKSDIKYYAKTGDTIEFMCK. |
|---|
| Other Names | complement factor H-related protein 4, CFHL4, complement factor H-related 4, FHR4, FHR-4 |
|---|
| Gene, Accession # | CFHR4, Gene ID: 10877, Accession: NP_001188480, SwissProt: NP_001188480 |
|---|
| Catalog # | NBP1-98532-20ul |
|---|
| Price | |
|---|
| Order / More Info | Complement Factor H-related 4/CFHR4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|