| Edit |   |
| Antigenic Specificity | E2f7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB,IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit polyclonal anti-E2f7 antibody |
| Immunogen | The immunogen for anti-E2f7 antibody: synthetic peptide directed towards the N terminal of mouse E2f7. Synthetic peptide located within the following region: MEVNCLTLKDLISPRQTRLDFAIEDAENAQKENIFVDRSRMTPKTPMKNE |
| Other Names | E2F transcription factor 7 |
| Gene, Accession # | E2f7, Accession: NM_178609 |
| Catalog # | TA329623 |
| Price | |
| Order / More Info | E2f7 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |