| Edit |   |
|---|
| Antigenic Specificity | EFCAB3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-EFCAB3 Antibody |
|---|
| Immunogen | The immunogen for anti-EFCAB3 antibody: synthetic peptide directed towards the N terminal of human EFCAB3. Synthetic peptide located within the following region: MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMA |
|---|
| Other Names | EF-hand calcium binding domain 3 |
|---|
| Gene, Accession # | EFCB3, Accession: NM_173503 |
|---|
| Catalog # | TA337784 |
|---|
| Price | |
|---|
| Order / More Info | EFCAB3 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|