| Edit |   |
|---|
| Antigenic Specificity | RFESD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RFESD Antibody from Novus Biologicals is a rabbit polyclonal antibody to RFESD. This antibody reacts with human. The RFESD Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RFESD(Rieske (Fe-S) domain containing) The peptide sequence was selected from the middle region of RFESD. Peptide sequence VVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHK. |
|---|
| Other Names | Rieske (Fe-S) domain containing, Rieske domain-containing protein |
|---|
| Gene, Accession # | RFESD, Gene ID: 317671, Accession: Q8TAC1, SwissProt: Q8TAC1 |
|---|
| Catalog # | NBP1-56910 |
|---|
| Price | |
|---|
| Order / More Info | RFESD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|