| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Carbonic Anhydrase III/CA3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Carbonic Anhydrase III/CA3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Carbonic Anhydrase III/CA3. This antibody reacts with human. The Carbonic Anhydrase III/CA3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Carbonic Anhydrase III/CA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK |
|---|
| Other Names | CAIII, CA-III, Car3, Carbonate dehydratase III, carbonic anhydrase 3, Carbonic anhydrase III, carbonic anhydrase III, muscle specific, EC 4.2.1.1 |
|---|
| Gene, Accession # | CA3, Gene ID: 761 |
|---|
| Catalog # | NBP1-88227 |
|---|
| Price | |
|---|
| Order / More Info | Carbonic Anhydrase III/CA3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24743550 |
|---|
| 产品资料 |
|
|