| Edit |   |
| Antigenic Specificity | FAM121B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, guinea pig, horse, rabbit |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-FAM121B Antibody |
| Immunogen | The immunogen for anti-FAM121B antibody: synthetic peptide directed towards the N terminal of human FAM121B. Synthetic peptide located within the following region: PASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQL |
| Other Names | FAM121B, apolipoprotein O |
| Gene, Accession # | APOO, Accession: NM_024122 |
| Catalog # | TA343927 |
| Price | |
| Order / More Info | FAM121B Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |