| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FGFR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FGFR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FGFR1. This antibody reacts with human. The FGFR1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FGF R1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTR |
|---|
| Other Names | basic fibroblast growth factor receptor 1, BFGFR, bFGF-R-1, CD331, CD331 antigen, CEK, EC 2.7.10, EC 2.7.10.1, FGFBR, FGFR-1, fibroblast growth factor receptor 1, FLGH3, FLJ99988, FLT-2, FLT2H4, Fms-like tyrosine kinase 2, fms-related tyrosine kinase 2, H2, H5, HBGFR, heparin-binding growth factor receptor, hydroxyaryl-protein kinase, KAL 2, KAL2, N-SAM, OGD, Proto-oncogene c-Fgr, soluble FGFR1 variant 1, soluble FGFR1 variant 2 |
|---|
| Gene, Accession # | FGFR1, Gene ID: 2260, Accession: P11362, SwissProt: P11362 |
|---|
| Catalog # | NBP2-33784 |
|---|
| Price | |
|---|
| Order / More Info | FGFR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|