| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FGFR2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FGFR2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FGFR2. This antibody reacts with human. The FGFR2 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human FGF R2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKR |
|---|
| Other Names | BBDS, BEK, BFR-1, CD332, CD332 antigen, CEK3, CFD1, craniofacial dysostosis 1, EC 2.7.10, EC 2.7.10.1, ECT1, fibroblast growth factor receptor 2, FLJ98662, Jackson-Weiss syndrome, JWS, Keratinocyte growth factor receptorreceptor like 14, KGFR, K-sam, KSAM, soluble FGFR4 variant 4, TK14, TK25 |
|---|
| Gene, Accession # | FGFR2, Gene ID: 2263 |
|---|
| Catalog # | NBP2-56776 |
|---|
| Price | |
|---|
| Order / More Info | FGFR2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|