| Edit |   |
| Antigenic Specificity | FGGY carbohydrate kinase domain containing |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FGGY carbohydrate kinase domain containing Antibody from Novus Biologicals is a rabbit polyclonal antibody to FGGY carbohydrate kinase domain containing. This antibody reacts with mouse. The FGGY carbohydrate kinase domain containing Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The specific Immunogen is proprietary information. Peptide sequence NETKHRVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLS. |
| Other Names | EC 2.7.1, EC 2.7.1.-, FGGY carbohydrate kinase domain containing, FGGY carbohydrate kinase domain-containing protein, FLJ10986 |
| Gene, Accession # | FGGY, Gene ID: 55277, Accession: NP_083623 |
| Catalog # | NBP1-79275 |
| Price | |
| Order / More Info | FGGY carbohydrate kinase domain containing Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |