| Edit |   |
|---|
| Antigenic Specificity | FGL2/Fibroleukin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FGL2/Fibroleukin Antibody from Novus Biologicals is a rabbit polyclonal antibody to FGL2/Fibroleukin. This antibody reacts with human. The FGL2/Fibroleukin Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FGL2 (fibrinogen-like 2) The peptide sequence was selected from the middle region of FGL2. Peptide sequence WTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL. |
|---|
| Other Names | fibrinogen-like 2, Fibrinogen-like protein 2, fibroleukin, pT49T49 |
|---|
| Gene, Accession # | FGL2, Gene ID: 10875, Accession: Q14314, SwissProt: Q14314 |
|---|
| Catalog # | NBP1-56965 |
|---|
| Price | |
|---|
| Order / More Info | FGL2/Fibroleukin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|