| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Fgr |
|---|
| Clone | 3G10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Fgr Antibody (3G10) from Novus Biologicals is a mouse monoclonal antibody to Fgr. This antibody reacts with human, mouse, rat. The Fgr Antibody (3G10) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | FGR (AAH64382, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA |
|---|
| Other Names | c-fgr, c-src2, c-src-2 proto-oncogene, EC 2.7.10, EC 2.7.10.2, FLJ43153, Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog, MGC75096, p55c-fgr, p55-c-fgr protein, p55-Fgr, p58c-fgr, Proto-oncogene c-Fgr, proto-oncogene tyrosine-protein kinase FGR, SRC2c-fgr protooncogene, tyrosine-protein kinase Fgr |
|---|
| Gene, Accession # | FGR, Gene ID: 2268, Accession: AAH64382, SwissProt: AAH64382 |
|---|
| Catalog # | H00002268-M01 |
|---|
| Price | |
|---|
| Order / More Info | Fgr Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|