| 产品详情 |
| Edit |   |
| Antigenic Specificity | FHIT |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 23019410). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FHIT Antibody from Novus Biologicals is a rabbit polyclonal antibody to FHIT. This antibody reacts with human. The FHIT Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FHIT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE |
| Other Names | AP3A hydrolase, AP3AaseFRA3Bbis(5'-adenosyl)-triphosphatase, Diadenosine 5'-5'''-P1, dinucleosidetriphosphatase, EC 3.6.1.29, fragile histidine triad gene, Fragile histidine triad protein, P3-triphosphate hydrolase, tumor suppressor protein |
| Gene, Accession # | FHIT, Gene ID: 2272 |
| Catalog # | NBP1-89062 |
| Price | |
| Order / More Info | FHIT Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 19287070, 23019410 |
| 产品资料 |
|
|