| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ORC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ORC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ORC1. This antibody reacts with human. The ORC1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ORC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YISGVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCTRGSPQETTVLLVDE |
|---|
| Other Names | HS, HSORC1, ORC1Lorigin recognition complex subunit 1, origin recognition complex, subunit 1, origin recognition complex, subunit 1 (yeast homolog)-like, origin recognition complex, subunit 1 homolog, origin recognition complex, subunit 1 homolog (S. cerevisiae), origin recognition complex, subunit 1-like, origin recognition complex, subunit 1-like (yeast), PARC1origin recognition complex 1, Replication control protein 1 |
|---|
| Gene, Accession # | ORC1, Gene ID: 4998, Accession: Q13415, SwissProt: Q13415 |
|---|
| Catalog # | NBP1-83184 |
|---|
| Price | |
|---|
| Order / More Info | ORC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|