| 产品详情 |
| Edit |   |
| Antigenic Specificity | Phospholipase C beta 2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Phospholipase C beta 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Phospholipase C beta 2. This antibody reacts with human. The Phospholipase C beta 2 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Phospholipase C beta 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ERHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKESVRACLRTCFPSEAKDKPERACECPPELCEQDPL |
| Other Names | EC 3.1.4.11, FLJ38135, Phosphoinositide phospholipase C-beta-2,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2, phospholipase C, beta 2, Phospholipase C-beta-2, PLC-beta-2 |
| Gene, Accession # | PLCB2, Gene ID: 5330 |
| Catalog # | NBP2-58951 |
| Price | |
| Order / More Info | Phospholipase C beta 2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|