| 产品详情 |
| Edit |   |
| Antigenic Specificity | Phospholipase C like 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Phospholipase C like 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Phospholipase C like 1. This antibody reacts with human. The Phospholipase C like 1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Phospholipase C like 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LRYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKEAKIRLKFKEIQKSKEKLTTRVTEEEF |
| Other Names | but catalytically inactive protein, inactive phospholipase C-like protein 1, MGC126580, MGC138190, phospholipase C, epsilon, phospholipase C-deleted in lung carcinoma, phospholipase C-like 1, phospholipase C-related but catalytically inactive protein, PLCE, PLCL, PLC-L1, PRIP |
| Gene, Accession # | PLCL1, Gene ID: 5334 |
| Catalog # | NBP1-80896 |
| Price | |
| Order / More Info | Phospholipase C like 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|