| Edit |   |
|---|
| Antigenic Specificity | Phospholipid Scramblase 1/PLSCR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Phospholipid Scramblase 1/PLSCR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Phospholipid Scramblase 1/PLSCR1. This antibody reacts with human. The Phospholipid Scramblase 1/PLSCR1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to PLSCR1(phospholipid scramblase 1) Antibody(against the N terminal of PLSCR1. Peptide sequence MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP. |
|---|
| Other Names | Erythrocyte phospholipid scramblase, MmTRA1b, MMTRA1BCa(2+)-dependent phospholipid scramblase 1, phospholipid scramblase 1, PL scramblase 1 |
|---|
| Gene, Accession # | PLSCR1, Gene ID: 5359, Accession: O15162, SwissProt: O15162 |
|---|
| Catalog # | NBP1-57816-20ul |
|---|
| Price | |
|---|
| Order / More Info | Phospholipid Scramblase 1/PLSCR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|